potassium voltage-gated channel, shaker-related subfamily, member 3, Mouse, Clone: 1D8, Abnova™

Catalog No.	Quantity
89-015-831	100 μg

Catalog No. 89-015-831 Supplier Abnova Corporation Supplier No. H00003738M01

Description

Mouse monoclonal antibody raised against a partial recombinant KCNA3.

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. [provided by RefSeq

Sequence: VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV

Specifications

• Antigen: potassium voltage-gated channel, shaker-related subfamily, member 3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant KCNA3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: KCNA3
• Gene Accession No.: BC035059
• Gene Alias: HGK5/HLK3/HPCN3/HUKIII/KV1.3/MK3/PCN3
• Gene Symbols: KCNA3
• Host Species: Mouse
• Immunogen: KCNA3 (AAH35059, 424 a.a. ∼ 523 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3738
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ