potassium voltage-gated channel, Isk-related family, member 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-005-664	50 μL

Catalog No. 89-005-664 Supplier Abnova Corporation Supplier No. H00003753B01

Description

Mouse polyclonal antibody raised against a full-length human KCNE1 protein.

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

Specifications

• Antigen: potassium voltage-gated channel, Isk-related family, member 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human KCNE1 protein.
• Formulation: No additive
• Gene: KCNE1
• Gene Accession No.: NM_000219.2
• Gene Alias: FLJ18426/FLJ38123/FLJ94103/ISK/JLNS/JLNS2/LQT2/5/LQT5/MGC33114/MinK
• Gene Symbols: KCNE1
• Host Species: Mouse
• Immunogen: KCNE1 (NP_000210.2, 1 a.a. ∼ 129 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3753
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum