potassium voltage-gated channel, subfamily G, member 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-811	50 μL

Catalog No. 89-004-811 Supplier Abnova Corporation Supplier No. H00170850A01

Description

Mouse polyclonal antibody raised against a partial recombinant KCNG3.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq

Sequence: SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS

Specifications

• Antigen: potassium voltage-gated channel, subfamily G, member 3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant KCNG3.
• Formulation: 50% glycerol
• Gene: KCNG3
• Gene Accession No.: NM_133329
• Gene Alias: KV10.1/KV6.3
• Gene Symbols: KCNG3
• Host Species: Mouse
• Immunogen: KCNG3 (NP_579875, 23 a.a. ∼ 121 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 170850
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum