Kv channel interacting protein 4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-008-248	50 μL

Catalog No. 89-008-248 Supplier Abnova Corporation Supplier No. H00080333B01

Description

Mouse polyclonal antibody raised against a full-length human KCNIP4 protein.

This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI

Specifications

• Antigen: Kv channel interacting protein 4
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human KCNIP4 protein.
• Formulation: No additive
• Gene: KCNIP4
• Gene Accession No.: NM_025221.5
• Gene Alias: CALP/KCHIP4/MGC44947
• Gene Symbols: KCNIP4
• Host Species: Mouse
• Immunogen: KCNIP4 (NP_079497.2, 1 a.a. ∼ 250 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 80333
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum