potassium inwardly-rectifying channel, subfamily J, member 10, Mouse, Clone: 1C11, Abnova™

Catalog No.	Quantity
89-014-134	100 μg

Catalog No. 89-014-134 Supplier Abnova Corporation Supplier No. H00003766M01

Description

Mouse monoclonal antibody raised against a partial recombinant KCNJ10.

This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq

Sequence: DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Specifications

• Antigen: potassium inwardly-rectifying channel, subfamily J, member 10
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant KCNJ10.
• Formulation: PBS with no preservative; pH 7.4
• Gene: KCNJ10
• Gene Accession No.: NM_002241
• Gene Alias: BIRK-10/KCNJ13-PEN/KIR1.2/KIR4.1
• Gene Symbols: KCNJ10
• Host Species: Mouse
• Immunogen: KCNJ10 (NP_002232, 276 a.a. ∼ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3766
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ