v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, Mouse, Clone: 6F2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant KIT.

Supplier:  Abnova Corporation H00003815M02

Catalog No. 89-000-768

Description

This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD

Specifications

• Antigen: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000222
• Gene Symbols: KIT
• Immunogen: KIT (NP_000213, 41 a.a. ∼ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 6F2
• Description: Mouse monoclonal antibody raised against a partial recombinant KIT.
• Gene: KIT
• Gene Alias: C-Kit/CD117/PBT/SCFR
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3815
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ