v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, Mouse, Clone: 6F2, Abnova™

Catalog No.	Quantity
89-000-768	100 μg

Catalog No. 89-000-768 Supplier Abnova Corporation Supplier No. H00003815M02

Description

Mouse monoclonal antibody raised against a partial recombinant KIT.

This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD

Specifications

• Antigen: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6F2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant KIT.
• Formulation: PBS with no preservative; pH 7.4
• Gene: KIT
• Gene Accession No.: NM_000222
• Gene Alias: C-Kit/CD117/PBT/SCFR
• Gene Symbols: KIT
• Host Species: Mouse
• Immunogen: KIT (NP_000213, 41 a.a. ∼ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3815
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ