KIT ligand, Mouse, Clone: 3C7, Abnova™

Catalog No.	Quantity
89-000-807	100 μg

Catalog No. 89-000-807 Supplier Abnova Corporation Supplier No. H00004254M02

Description

Mouse monoclonal antibody raised against a partial recombinant KITLG.

This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV

Specifications

• Antigen: KIT ligand
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3C7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant KITLG.
• Formulation: PBS with no preservative; pH 7.4
• Gene: KITLG
• Gene Accession No.: NM_003994
• Gene Alias: DKFZp686F2250/KL-1/Kitl/MGF/SCF/SF/SHEP7
• Gene Symbols: KITLG
• Host Species: Mouse
• Immunogen: KITLG (NP_003985, 26 a.a. ∼ 245 a.a) partial recombinant protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4254
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ