Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016372

KLF5, Mouse, Clone: 2G12, Abnova™

Catalog No. 89016372 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-372 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-372 Supplier Abnova Corporation Supplier No. H00000688M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant KLF5.

This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, it is thought to be a transcription factor. [provided by RefSeq

Sequence: RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN

Specifications

Antigen KLF5
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2G12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant KLF5.
Formulation PBS with no preservative; pH 7.4
Gene KLF5
Gene Accession No. NM_001730
Gene Alias BTEB2/CKLF/IKLF
Gene Symbols KLF5
Host Species Mouse
Immunogen KLF5 (NP_001721, 358 a.a. ∼ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 688
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.