Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLF9, Mouse, Clone: 1H5, Abnova™

Catalog No. 89016371 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-371 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-371 Supplier Abnova Corporation Supplier No. H00000687M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant KLF9.

The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription. [provided by RefSeq

Sequence: PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT

Specifications

Antigen KLF9
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1H5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant KLF9.
Formulation PBS with no preservative; pH 7.4
Gene KLF9
Gene Accession No. NM_001206
Gene Alias BTEB/BTEB1
Gene Symbols KLF9
Host Species Mouse
Immunogen KLF9 (NP_001197, 25 a.a. ∼ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 687
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.