KLF9, Mouse, Clone: 1H5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant KLF9.

Supplier:  Abnova Corporation H00000687M01

Catalog No. 89-016-371

Description

The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription. [provided by RefSeq

Sequence: PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT

Specifications

• Antigen: KLF9
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001206
• Gene Symbols: KLF9
• Immunogen: KLF9 (NP_001197, 25 a.a. ∼ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1H5
• Description: Mouse monoclonal antibody raised against a partial recombinant KLF9.
• Gene: KLF9
• Gene Alias: BTEB/BTEB1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 687
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid