KLK8, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-131	50 μL

Catalog No. 89-003-131 Supplier Abnova Corporation Supplier No. H00011202A01

Description

Mouse polyclonal antibody raised against a partial recombinant KLK8.

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. [provided by RefSeq

Sequence: EIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKG

Specifications

• Antigen: KLK8
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant KLK8.
• Formulation: 50% glycerol
• Gene: KLK8
• Gene Accession No.: NM_007196
• Gene Alias: HNP/NP/NRPN/PRSS19/TADG14
• Gene Symbols: KLK8
• Host Species: Mouse
• Immunogen: KLK8 (NP_009127, 97 a.a. ∼ 204 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11202
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid