Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

kallikrein-related peptidase 8, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human KLK8 protein.

Manufacturer:  Abnova Corporation H00011202B01P

Catalog No. 89-017-020


  Check Availability
Add to cart

Specifications

Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. [provided by RefSeq

Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
Description & Specifications

Specifications

kallikrein-related peptidase 8
Unlabeled
kallikrein-related peptidase 8
In 1X PBS, pH 7.4
NM_007196
KLK8
KLK8 (NP_009127.1, 1 a.a. ∽260 a.a) full-length human protein.
50μg
Neurobiology
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
Human
Affinity Purified
KLK8
HNP, NP, NRPN, PRSS19, TADG14
Murine
Protein A column
RUO
Human
Primary
11202
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit