kallikrein-related peptidase 8, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human KLK8 protein.

Manufacturer: Abnova Corporation H00011202B01P

Catalog No. 89-017-020

  Check Availability
Add to Cart

    Specifications

    Antigen kallikrein-related peptidase 8
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description kallikrein-related peptidase 8
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene KLK8
    Gene Accession No. NM_007196
    Gene Alias HNP, NP, NRPN, PRSS19, TADG14
    Gene Symbols KLK8
    Host Species Mouse
    Immunogen KLK8 (NP_009127.1, 1 a.a. ∽260 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 50μg
    Regulatory Status RUO
    Research Discipline Neurobiology
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 11202

    Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. [provided by RefSeq

    Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit