killer cell lectin-like receptor subfamily C, member 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant KLRC1.

Supplier:  Abnova Corporation H00003821A01

Catalog No. 89-004-182

Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq

Sequence: MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK

Specifications

• Antigen: killer cell lectin-like receptor subfamily C, member 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant KLRC1.
• Gene: KLRC1
• Gene Alias: CD159A/MGC13374/MGC59791/NKG2/NKG2A
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_213658
• Gene Symbols: KLRC1
• Immunogen: KLRC1 (NP_998823, 1 a.a. ∼ 70 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3821
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.