karyopherin alpha 3 (importin alpha 4), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant KPNA3.

Supplier:  Abnova Corporation H00003839A01

Catalog No. 89-004-184

Description

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70kDa) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq

Sequence: VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF

Specifications

• Antigen: karyopherin alpha 3 (importin alpha 4)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant KPNA3.
• Gene: KPNA3
• Gene Alias: IPOA4/SRP1/SRP1gamma/SRP4/hSRP1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 3839
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002267
• Gene Symbols: KPNA3
• Immunogen: KPNA3 (NP_002258, 422 a.a. ∼ 521 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum