karyopherin alpha 3 (importin alpha 4), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-184	50 μL

Catalog No. 89-004-184 Supplier Abnova Corporation Supplier No. H00003839A01

Description

Mouse polyclonal antibody raised against a partial recombinant KPNA3.

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70kDa) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import. [provided by RefSeq

Sequence: VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF

Specifications

• Antigen: karyopherin alpha 3 (importin alpha 4)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant KPNA3.
• Formulation: 50% glycerol
• Gene: KPNA3
• Gene Accession No.: NM_002267
• Gene Alias: IPOA4/SRP1/SRP1gamma/SRP4/hSRP1
• Gene Symbols: KPNA3
• Host Species: Mouse
• Immunogen: KPNA3 (NP_002258, 422 a.a. ∼ 521 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3839
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum