v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog, Mouse, Clone: 4F3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant KRAS.

Supplier:  Abnova Corporation H00003845M02

Catalog No. 89-000-769

Description

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq

Sequence: KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV

Specifications

• Antigen: v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004985
• Gene Symbols: KRAS
• Immunogen: KRAS (NP_004976, 16 a.a. ∼ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4F3
• Description: Mouse monoclonal antibody raised against a partial recombinant KRAS.
• Gene: KRAS
• Gene Alias: C-K-RAS/K-RAS2A/K-RAS2B/K-RAS4A/K-RAS4B/KI-RAS/KRAS1/KRAS2/NS3/RASK2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3845
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ