kringle containing transmembrane protein 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant KREMEN1.

Supplier:  Abnova Corporation H00083999A01

Catalog No. 89-004-737

Description

This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq

Sequence: INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE

Specifications

• Antigen: kringle containing transmembrane protein 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant KREMEN1.
• Gene: KREMEN1
• Gene Alias: FLJ31863/KREMEM1/KREMEN/KRM1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_032045
• Gene Symbols: KREMEN1
• Immunogen: KREMEN1 (NP_114434, 310 a.a. ∼ 391 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 83999
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.