keratin 8 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-187	50 μL

Catalog No. 89-004-187 Supplier Abnova Corporation Supplier No. H00003856A01

Description

Mouse polyclonal antibody raised against a partial recombinant KRT8.

This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. [provided by RefSeq

Sequence: EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL

Specifications

• Antigen: keratin 8
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant KRT8.
• Formulation: 50% glycerol
• Gene: KRT8
• Gene Accession No.: NM_002273
• Gene Alias: CARD2/CK8/CYK8/K2C8/K8/KO
• Gene Symbols: KRT8
• Host Species: Mouse
• Immunogen: KRT8 (NP_002264, 91 a.a. ∼ 195 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3856
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum