L1CAM, Mouse, Clone: 3B10, Abnova™

Catalog No.	Quantity
89-123-206	100 μg

Catalog No. 89-123-206 Supplier Abnova Corporation Supplier No. H00003897M11

Description

Mouse monoclonal antibody raised against a partial recombinant L1CAM.

The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause three X-linked neurological syndromes known by the acronym CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of a neuron-specific exon is thought to be functionally relevant. [provided by RefSeq

Sequence: PEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMA

Specifications

• Antigen: L1CAM
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant L1CAM.
• Formulation: PBS with no preservative; pH 7.4
• Gene: L1CAM
• Gene Accession No.: NM_000425
• Gene Alias: CAML1/CD171/HSAS/HSAS1/MASA/MIC5/N-CAML1/S10/SPG1
• Gene Symbols: L1CAM
• Host Species: Mouse
• Immunogen: L1CAM (NP_000416, 23 a.a. ∼ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3897
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ