Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001188

ladybird homeobox 1, Mouse, Clone: 2B2, Abnova™

Catalog No. 89001188 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-188 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-188 Supplier Abnova Corporation Supplier No. H00010660M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant LBX1.

This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. [provided by RefSeq

Sequence: TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA

Specifications

Antigen ladybird homeobox 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant LBX1.
Formulation PBS with no preservative; pH 7.4
Gene LBX1
Gene Accession No. NM_006562
Gene Alias HPX-6/HPX6/LBX1H/homeobox
Gene Symbols LBX1
Host Species Mouse
Immunogen LBX1 (NP_006553.2, 133 a.a. ∼ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10660
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.