LIM domain binding 1, Mouse, Clone: 4G8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant LDB1.

Supplier:  Abnova Corporation H00008861M03

Catalog No. 89-001-106

Description

Sequence: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHP

Specifications

• Antigen: LIM domain binding 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003893
• Gene Symbols: LDB1
• Immunogen: LDB1 (NP_003884, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4G8
• Description: Mouse monoclonal antibody raised against a partial recombinant LDB1.
• Gene: LDB1
• Gene Alias: CLIM2/NLI
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 8861
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ