LDLR, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-016	50 μL

Catalog No. 89-003-016 Supplier Abnova Corporation Supplier No. H00003949A01

Description

Mouse polyclonal antibody raised against a partial recombinant LDLR.

The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. [provided by RefSeq

Sequence: PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL

Specifications

• Antigen: LDLR
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LDLR.
• Formulation: 50% glycerol
• Gene: LDLR
• Gene Accession No.: NM_000527
• Gene Alias: FH/FHC
• Gene Symbols: LDLR
• Host Species: Mouse
• Immunogen: LDLR (NP_000518, 105 a.a. ∼ 205 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3949
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid