low density lipoprotein receptor, Mouse, Clone: 5E7, Abnova™

Catalog No.	Quantity
89-019-050	100 μg

Catalog No. 89-019-050 Supplier Abnova Corporation Supplier No. H00003949M01

Description

Mouse monoclonal antibody raised against a partial recombinant LDLR.

The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. [provided by RefSeq

Sequence: PPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCL

Specifications

• Antigen: low density lipoprotein receptor
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5E7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LDLR.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LDLR
• Gene Accession No.: NM_000527
• Gene Alias: FH/FHC
• Gene Symbols: LDLR
• Host Species: Mouse
• Immunogen: LDLR (NP_000518, 105 a.a. ∼ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3949
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ