leucine zipper, down-regulated in cancer 1, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-038	50 μg

Catalog No. 89-017-038 Supplier Abnova Corporation Supplier No. H00023641B01P

Description

Mouse polyclonal antibody raised against a full-length human LDOC1 protein.

The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq

Sequence: MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY

Specifications

• Antigen: leucine zipper, down-regulated in cancer 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human LDOC1 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LDOC1
• Gene Accession No.: NM_012317
• Gene Alias: BCUR1/Mar7/Mart7
• Gene Symbols: LDOC1
• Host Species: Mouse
• Immunogen: LDOC1 (NP_036449.1, 1 a.a. ∼ 146 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 23641
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG