lymphoid enhancer-binding factor 1, Mouse, Clone: 5A3, Abnova™

Catalog No.	Quantity
89-001-278	100 μg

Catalog No. 89-001-278 Supplier Abnova Corporation Supplier No. H00051176M03

Description

Mouse monoclonal antibody raised against a partial recombinant LEF1.

LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]).[supplied by OMIM

Sequence: DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNND

Specifications

• Antigen: lymphoid enhancer-binding factor 1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 5A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LEF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LEF1
• Gene Accession No.: NM_016269
• Gene Alias: DKFZp586H0919/TCF1ALPHA
• Gene Symbols: LEF1
• Host Species: Mouse
• Immunogen: LEF1 (NP_057353, 14 a.a. ∼ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51176
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ