lectin, galactoside-binding, soluble, 9, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-191	50 μL

Catalog No. 89-004-191 Supplier Abnova Corporation Supplier No. H00003965A01

Description

Mouse polyclonal antibody raised against a partial recombinant LGALS9.

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Sequence: FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Specifications

• Antigen: lectin, galactoside-binding, soluble, 9
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LGALS9.
• Formulation: 50% glycerol
• Gene: LGALS9
• Gene Accession No.: NM_009587
• Gene Alias: HUAT/LGALS9A/MGC117375/MGC125973/MGC125974
• Gene Symbols: LGALS9
• Host Species: Mouse
• Immunogen: LGALS9 (NP_033665, 254 a.a. ∼ 355 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3965
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum