LHX1, Mouse, Clone: 4G5, Abnova™

Catalog No.	Quantity
89-123-217	100 μg

Catalog No. 89-123-217 Supplier Abnova Corporation Supplier No. H00003975M12

Description

Mouse monoclonal antibody raised against a partial recombinant LHX1.

This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer. [provided by RefSeq

Sequence: MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST

Specifications

• Antigen: LHX1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4G5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LHX1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LHX1
• Gene Accession No.: NM_005568
• Gene Alias: LIM-1/LIM1/MGC126723/MGC138141
• Gene Symbols: LHX1
• Host Species: Mouse
• Immunogen: LHX1 (NP_005559, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3975
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ