LIM homeobox 6, Mouse, Clone: 3E8, Abnova™

Catalog No.	Quantity
89-001-244	100 μg

Catalog No. 89-001-244 Supplier Abnova Corporation Supplier No. H00026468M05

Description

Mouse monoclonal antibody raised against a partial recombinant LHX6.

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq

Sequence: HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY

Specifications

• Antigen: LIM homeobox 6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LHX6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LHX6
• Gene Accession No.: NM_014368
• Gene Alias: LHX6.1/MGC119542/MGC119544/MGC119545
• Gene Symbols: LHX6
• Host Species: Mouse
• Immunogen: LHX6 (NP_055183, 274 a.a. ∼ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26468
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ