Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LIM homeobox 6, Mouse, Clone: 3E8, Abnova™

Catalog No. 89001244 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-244 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-244 Supplier Abnova Corporation Supplier No. H00026468M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant LHX6.

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq

Sequence: HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY

Specifications

Antigen LIM homeobox 6
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3E8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant LHX6.
Formulation PBS with no preservative; pH 7.4
Gene LHX6
Gene Accession No. NM_014368
Gene Alias LHX6.1/MGC119542/MGC119544/MGC119545
Gene Symbols LHX6
Host Species Mouse
Immunogen LHX6 (NP_055183, 274 a.a. ∼ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 26468
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.