leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-214	100 μg

Catalog No. 89-018-214 Supplier Abnova Corporation Supplier No. H00010288D01P

Description

Rabbit polyclonal antibody raised against a full-length human LILRB2 protein.

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV

Specifications

• Antigen: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human LILRB2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LILRB2
• Gene Accession No.: BC041708.1
• Gene Alias: CD85D/ILT4/LILRA6/LIR-2/LIR2/MIR-10/MIR10
• Gene Symbols: LILRB2
• Host Species: Rabbit
• Immunogen: LILRB2 (AAH41708.1, 1 a.a. ∼ 193 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Gene ID (Entrez): 10288
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG