Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

lethal giant larvae homolog 1 (Drosophila), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LLGL1.

Manufacturer:  Abnova Corporation H00003996A01

Catalog No. 89-004-194


Add to cart

Description

Description

This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq

Sequence: GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
Specifications

Specifications

lethal giant larvae homolog 1 (Drosophila)
Unconjugated
50% glycerol
NM_004140
DLG4|HUGL|HUGL-1|HUGL1|LLGL
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
3996
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant LLGL1.
LLGL1
Serum
LLGL1
LLGL1 (NP_004131, 911 a.a. ~ 1010 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit