lethal giant larvae homolog 2 (Drosophila), Mouse, Clone: 4G2, Abnova™

Catalog No.	Quantity
89-014-141	100 μg

Catalog No. 89-014-141 Supplier Abnova Corporation Supplier No. H00003993M06

Description

Mouse monoclonal antibody raised against a partial recombinant LLGL2.

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR

Specifications

• Antigen: lethal giant larvae homolog 2 (Drosophila)
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4G2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LLGL2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LLGL2
• Gene Accession No.: NM_004524
• Gene Alias: HGL/LGL2
• Gene Symbols: LLGL2
• Host Species: Mouse
• Immunogen: LLGL2 (NP_004515, 101 a.a. ∼ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 3993
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ