LIM and cysteine-rich domains 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-608	50 μL

Catalog No. 89-004-608 Supplier Abnova Corporation Supplier No. H00029995A01

Description

Mouse polyclonal antibody raised against a partial recombinant LMCD1.

The protein encoded by this gene contains a cysteine-rich domain in the N-terminal region and 2 LIM domains in the C-terminal region. It also has several potential phosphorylation and N-myristoylation sites and a single potential N-glycosylation site. The presence of LIM domains implies involvement in protein-protein interactions. Expression of this gene has been detected in most tissues, with highest expression in skeletal muscle. Transcript variants utilizing alternative polyA signals have been observed. [provided by RefSeq

Sequence: KQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKR

Specifications

• Antigen: LIM and cysteine-rich domains 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LMCD1.
• Formulation: 50% glycerol
• Gene: LMCD1
• Gene Accession No.: NM_014583
• Gene Symbols: LMCD1
• Host Species: Mouse
• Immunogen: LMCD1 (NP_055398, 266 a.a. ∼ 364 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 29995
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum