Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000779

LIM domain only 1 (rhombotin 1), Mouse, Clone: 1A9, Abnova™

Catalog No. 89000779 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-779 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-779 Supplier Abnova Corporation Supplier No. H00004004M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant LMO1.

LMO1 enocdes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted. [provided by RefSeq

Sequence: MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA

Specifications

Antigen LIM domain only 1 (rhombotin 1)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1A9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant LMO1.
Formulation PBS with no preservative; pH 7.4
Gene LMO1
Gene Accession No. NM_002315
Gene Alias MGC116692/RBTN1/RHOM1/TTG1
Gene Symbols LMO1
Host Species Mouse
Immunogen LMO1 (NP_002306, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4004
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.