LIM domain only 2 (rhombotin-like 1), Mouse, Clone: 2B3, Abnova™

Catalog No.	Quantity
89-000-780	100 μg

Catalog No. 89-000-780 Supplier Abnova Corporation Supplier No. H00004005M02

Description

Mouse monoclonal antibody raised against a full-length recombinant LMO2.

LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms

Sequence: MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRPFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

Specifications

• Antigen: LIM domain only 2 (rhombotin-like 1)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2B3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant LMO2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LMO2
• Gene Accession No.: BC034041
• Gene Alias: RBTN2/RBTNL1/RHOM2/TTG2
• Gene Symbols: LMO2
• Host Species: Mouse
• Immunogen: LMO2 (AAH34041, 1 a.a. ∼ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4005
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ