LIM domain only 2 (rhombotin-like 1), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-818	100 μg

Catalog No. 89-017-818 Supplier Abnova Corporation Supplier No. H00004005D01P

Description

Rabbit polyclonal antibody raised against a full-length human LMO2 protein.

LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms

Sequence: MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

Specifications

• Antigen: LIM domain only 2 (rhombotin-like 1)
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human LMO2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LMO2
• Gene Accession No.: NM_005574.2
• Gene Alias: RBTN2/RBTNL1/RHOM2/TTG2
• Gene Symbols: LMO2
• Host Species: Rabbit
• Immunogen: LMO2 (NP_005565.1, 1 a.a. ∼ 158 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4005
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG