cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-780	50 μL

Catalog No. 89-004-780 Supplier Abnova Corporation Supplier No. H00129607A01

Description

Mouse polyclonal antibody raised against a partial recombinant CMPK2.

Mitochondrial UMP-CMP kinase (EC 2.7.2.14) is a component of the salvage pathway for nucleotide synthesis. Other enzymes of the salvage pathway include thymidine kinase-2 (TK2; MIM 188250), deoxynucleotidase-2 (NT5M; MIM 605292), deoxyguanosine kinase (DGUOK; MIM 601465), adenylate kinase-2 (AK2; MIM 103020), adenylate kinase-3 (AK3; MIM 609290), adenylate kinase-3-like-1 (AK3L1; MIM 103030), and nucleoside diphosphate kinase (NME4; MIM 601818) (Xu et al., 2008 [PubMed 17999954]).[supplied by OMIM

Sequence: GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG

Specifications

• Antigen: cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CMPK2.
• Formulation: 50% glycerol
• Gene: CMPK2
• Gene Accession No.: NM_207315
• Gene Alias: TYKi/UMP-CMPK2
• Gene Symbols: CMPK2
• Host Species: Mouse
• Immunogen: CMPK2 (NP_997198, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 129607
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum