Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ret finger protein-like 4B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RFPL4B.

Manufacturer:  Abnova Corporation H00442247A01

Catalog No. 89-004-835


Add to cart

Description

Description

Sequence: TKDPRLACVLGTPCFSSGQHYWEVEVGEVKSWSLGVCKEPADRKSNDLFPGHGFWISMKAGAIHANTHLERIPASPRLRRVGIFLDADLEEIQFFDVDNN
Specifications

Specifications

ret finger protein-like 4B
Unconjugated
50% glycerol
NM_001013734
RNF211
Mouse
50 uL
Ubiquitin/Proteasome
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant RFPL4B.
RFPL4B
Serum
RFPL4B
RFPL4B (NP_001013756, 127 a.a. ~ 226 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
442247
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit