lysyl oxidase-like 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-015-816	50 μL

Catalog No. 89-015-816 Supplier Abnova Corporation Supplier No. H00004017A01

Description

Mouse polyclonal antibody raised against a partial recombinant LOXL2.

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq

Sequence: NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP

Specifications

• Antigen: lysyl oxidase-like 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LOXL2.
• Formulation: 50% glycerol
• Gene: LOXL2
• Gene Accession No.: NM_002318
• Gene Alias: LOR2/WS9-14
• Gene Symbols: LOXL2
• Host Species: Mouse
• Immunogen: LOXL2 (NP_002309, 675 a.a. ∼ 773 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4017
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum