lysyl oxidase-like 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LOXL3.

Supplier:  Abnova Corporation H00084695A01

Catalog No. 89-004-744

Description

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Alternatively spliced transcript variants of this gene have been reported but their full-length nature has not been determined. [provided by RefSeq

Sequence: IRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTAR

Specifications

• Antigen: lysyl oxidase-like 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant LOXL3.
• Gene: LOXL3
• Gene Alias: LOXL
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Endocrine/Metabolism
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_032603
• Gene Symbols: LOXL3
• Immunogen: LOXL3 (NP_115992, 171 a.a. ∼ 270 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 84695
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.