low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, Mouse, Clone: 3H2, Abnova™

Catalog No.	Quantity
89-014-214	100 μg

Catalog No. 89-014-214 Supplier Abnova Corporation Supplier No. H00007804M01

Description

Mouse monoclonal antibody raised against a partial recombinant LRP8.

This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq

Sequence: KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH

Specifications

• Antigen: low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LRP8.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LRP8
• Gene Accession No.: NM_004631
• Gene Alias: APOER2/HSZ75190/MCI1
• Gene Symbols: LRP8
• Host Species: Mouse
• Immunogen: LRP8 (NP_004622, 83 a.a. ∼ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Gene ID (Entrez): 7804
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ