low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LRP8.

Supplier:  Abnova Corporation H00007804A01

Catalog No. 89-004-370

Description

This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq

Sequence: KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH

Specifications

• Antigen: low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant LRP8.
• Gene: LRP8
• Gene Alias: APOER2/HSZ75190/MCI1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004631
• Gene Symbols: LRP8
• Immunogen: LRP8 (NP_004622, 83 a.a. ∼ 170 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7804
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.