Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89002649

LRRC4C, Mouse, Clone: 1G5, Abnova™

Catalog No. 89002649 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-649 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-649 Supplier Abnova Corporation Supplier No. H00057689M05
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant LRRC4C.

NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM

Sequence: AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI

Specifications

Antigen LRRC4C
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1G5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant LRRC4C.
Formulation PBS with no preservative; pH 7.4
Gene LRRC4C
Gene Accession No. NM_020929
Gene Alias KIAA1580/NGL-1/NGL1
Gene Symbols LRRC4C
Host Species Mouse
Immunogen LRRC4C (NP_065980.1, 541 a.a. ∼ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57689
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.