Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

tsukushin, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LRRC54.

Manufacturer:  Abnova Corporation H00025987A01

Catalog No. 89-004-578


Add to cart

Description

Description

Sequence: PGLQVLDLSGNPKLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLLHLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRDSAARGPTIL
Specifications

Specifications

tsukushin
Unconjugated
50% glycerol
NM_015516
E2IG4|LRRC54|TSK
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
25987
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant LRRC54.
TSKU
Serum
TSKU
LRRC54 (NP_056331, 254 a.a. ~ 353 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit