leucine-rich repeat kinase 2, Mouse, Clone: 3B2, Abnova™

Catalog No.	Quantity
89-014-347	100 μg

Catalog No. 89-014-347 Supplier Abnova Corporation Supplier No. H00120892M01

Description

Mouse monoclonal antibody raised against a partial recombinant LRRK2.

This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8. [provided by RefSeq

Sequence: NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK

Specifications

• Antigen: leucine-rich repeat kinase 2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LRRK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LRRK2
• Gene Accession No.: AY792511
• Gene Alias: AURA17/DARDARIN/PARK8/RIPK7/ROCO2
• Gene Symbols: LRRK2
• Host Species: Mouse
• Immunogen: LRRK2 (AAV63975, 2161 a.a. ∼ 2260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 120892
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ