LRRK2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LRRK2.

Supplier:  Abnova Corporation H00120892A01

Catalog No. 89-003-173

Description

This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8. [provided by RefSeq

Sequence: NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK

Specifications

• Antigen: LRRK2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant LRRK2.
• Gene: LRRK2
• Gene Alias: AURA17/DARDARIN/PARK8/RIPK7/ROCO2
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: AY792511
• Gene Symbols: LRRK2
• Immunogen: LRRK2 (AAV63975, 2161 a.a. ∼ 2260 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 120892
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.