LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-698	50 μL

Catalog No. 89-004-698 Supplier Abnova Corporation Supplier No. H00057819A01

Description

Mouse polyclonal antibody raised against a partial recombinant LSM2.

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM

Sequence: MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Specifications

• Antigen: LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LSM2.
• Formulation: 50% glycerol
• Gene: LSM2
• Gene Accession No.: NM_021177
• Gene Alias: C6orf28/G7b/YBL026W/snRNP
• Gene Symbols: LSM2
• Host Species: Mouse
• Immunogen: LSM2 (NP_067000, 1 a.a. ∼ 95 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 57819
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum