prostaglandin reductase 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LTB4DH.

Supplier:  Abnova Corporation H00022949A01

Catalog No. 89-004-550

Description

This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK

Specifications

• Antigen: prostaglandin reductase 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant LTB4DH.
• Gene: PTGR1
• Gene Alias: LTB4DH/MGC34943/ZADH3
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 22949
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_012212
• Gene Symbols: PTGR1
• Immunogen: LTB4DH (NP_036344, 230 a.a. ∼ 328 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum