Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LY6D, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human LY6D protein.

Manufacturer:  Abnova Corporation H00008581B02

Catalog No. 89-006-597


Add to cart

Description

Description

Sequence: MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL
Specifications

Specifications

LY6D
Unconjugated
No additive
NM_003695.2
E48
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8581
Western Blot
Mouse polyclonal antibody raised against a full-length human LY6D protein.
LY6D
Serum
LY6D
LY6D (NP_003686.1, 1 a.a. ~ 128 a.a) full-length human protein.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit