Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123223

LY6H, Mouse, Clone: 1D1, Abnova™

Catalog No. 89123223 Shop All Abnova Corporation Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-223 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Catalog No. 89-123-223 Supplier Abnova Corporation Supplier No. H00004062M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant LY6H.

Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP

Specifications

Antigen LY6H
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant LY6H.
Formulation PBS with no preservative; pH 7.4
Gene LY6H
Gene Accession No. BC028894
Gene Alias NMLY6
Gene Symbols LY6H
Host Species Mouse
Immunogen LY6H (AAH28894, 26 a.a. ∼ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4062
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.