melanoma antigen family A, 11, Mouse, Clone: 3A6, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant MAGEA11.

Supplier:  Abnova Corporation H00004110M01A

Catalog No. 89-001-469

Description

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV

Specifications

• Antigen: melanoma antigen family A, 11
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC004479.1
• Gene Symbols: MAGEA11
• Immunogen: MAGEA11 (AAH04479.1, 1 a.a. ∼ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ

• Applications: ELISA, Western Blot
• Clone: 3A6
• Description: Mouse monoclonal antibody raised against a full length recombinant MAGEA11.
• Gene: MAGEA11
• Gene Alias: MAGE-11/MAGE11/MAGEA-11/MGC10511
• Host Species: Mouse
• Quantity: 200 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 4110
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites