Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MAGI2, Mouse, Clone: 6F5, Abnova™

Catalog No. 89002763 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-763 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-763 Supplier Abnova Corporation Supplier No. H00009863M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant MAGI2.

The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. [provided by RefSeq

Sequence: PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV

Specifications

Antigen MAGI2,
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6F5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MAGI2.
Formulation PBS with no preservative; pH 7.4
Gene MAGI2
Gene Accession No. NM_012301
Gene Alias ACVRIP1/AIP1/ARIP1/MAGI-2/SSCAM
Gene Symbols MAGI2
Host Species Mouse
Immunogen MAGI2 (NP_036433, 519 a.a. ∼ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9863
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.