MAGI2, Mouse, Clone: 6F5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MAGI2.

Supplier:  Abnova Corporation H00009863M02

Catalog No. 89-002-763

Description

The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. [provided by RefSeq

Sequence: PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV

Specifications

• Antigen: MAGI2,
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_012301
• Gene Symbols: MAGI2
• Immunogen: MAGI2 (NP_036433, 519 a.a. ∼ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 6F5
• Description: Mouse monoclonal antibody raised against a partial recombinant MAGI2.
• Gene: MAGI2
• Gene Alias: ACVRIP1/AIP1/ARIP1/MAGI-2/SSCAM
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 9863
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid