male germ cell-associated kinase, Mouse, Clone: 3E5, Abnova™

Catalog No.	Quantity
89-000-792	100 μg

Catalog No. 89-000-792 Supplier Abnova Corporation Supplier No. H00004117M01

Description

Mouse monoclonal antibody raised against a partial recombinant MAK.

The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized. [provided by RefSeq

Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL

Specifications

• Antigen: male germ cell-associated kinase
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3E5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAK.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAK
• Gene Accession No.: BC039825
• Gene Alias: dJ417M14.2
• Gene Symbols: MAK
• Host Species: Mouse
• Immunogen: MAK (AAH39825, 358 a.a. ∼ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4117
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ